PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G234100.1.p
Common NameGLYMA_10G234100, LOC100786118
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 992aa    MW: 109784 Da    PI: 5.568
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G234100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.51.3e-28585635252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Glyma.10G234100.1.p 585 EKSISLEVLQRYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 635
                          799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.53574655IPR003035RWP-RK domain
PfamPF020421.8E-25588635IPR003035RWP-RK domain
SuperFamilySSF542778.83E-24892981No hitNo description
PROSITE profilePS5174525.474896978IPR000270PB1 domain
SMARTSM006665.5E-27896978IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.7E-27896977No hitNo description
PfamPF005645.4E-19896977IPR000270PB1 domain
CDDcd064072.21E-38897977No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MSEPEEENNQ DYVPRSKPAE EGGGGCTTMD FDLDLETSWP LDHMAFGSNP MSPFLFSTSS  60
DQPYSPLWAF SDGEDPKLPA SAFSDCHKIF SCDSNSIAEK PVENDDNKKN LPPLVPMPPV  120
ENLDGYCVIK ERMTQALRYF KELTELNVLA QVWAPVRNGN RYVLTTSGQP FVLDPHSNGL  180
HQYRTVSLMY MFSVDGENDG SLGLPGRVFQ QKLPEWTPNV QYYSSKEYPR RDHAQHYNVR  240
GTLALPVFEP SIQSCVGVLE LIMTSPKINY APEVDKICKA LETVNLRSSE ILDHPYTQIC  300
NEGRQNALSE ILEILTVVCE TLNLPLAQTW IPCKHRSVLA QGGGVKKSCS SFDGSCMGKV  360
CMSTTDIAFY IIDAHLWGFR EACVEHHLQQ GQGVAGRAFL SHSMCFCSNI TQFCKTDYPL  420
VHYALMFGLT SCFTICLRSS HTGNDDYVLE FFLPPRITDF HEQKTLLGSI LAIMKQHFQS  480
LKIASGVELE DGSIEIIEAT IERVHTRHES IPITPSIKSP PRLDTSPNMG EEVPQDPSEQ  540
QILMYCNDMN DGRSLGKNAD GIDHMPSIET KNIKKPLERK RGKTEKSISL EVLQRYFAGS  600
LKDAAKSLGV CPTTMKRICR QHGISRWPSR KINKVNRSLS KLKRVIESVQ GAEGAFGLNS  660
LSKSPLPIAV GSFPEPSTPN KFSQSASLSI KPSEPQVKEN ELNASKALEA NRQAGMEDQL  720
LGGRTQNLEK VINDKGGYTR EVGREPKRTR TRNGSSEDST NPTSHGSCHD SPPNESSPVK  780
DIFITSNNDQ CAGIKRSPES TLQPTINTPS RPTAYPMPDF VAVELQEPFG GMLIEDAGSS  840
KDLRNLCPLV AEVILEDMIP EACGTNLPGP DLSPKLSMGT PNKAVTPFAA MKEMKTVTIK  900
ATYREDIIRF RVSLTCGIVE LKEEIAKRLK LEVGTFDIKY LDDDHEWVLI ACDADLQECM  960
DVSRSSGSNI IRVLVHDITS NLGSSCESSG E*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.390370.0somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536463.20.0PREDICTED: protein NLP6-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A0B2QQ210.0A0A0B2QQ21_GLYSO; Protein NLP7
TrEMBLK7LL190.0K7LL19_SOYBN; Uncharacterized protein
STRINGGLYMA10G37860.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7